MYO10 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12471S
Article Name: MYO10 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12471S
Supplier Catalog Number: CNA12471S
Alternative Catalog Number: MBL-CNA12471S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 845-944 of human MYO10 (NP_036466.2).
Conjugation: Unconjugated
Alternative Names: MyoX
Clonality: Polyclonal
Molecular Weight: 237kDa
NCBI: 4651
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: EAELRAQQEEETRKQQELEALQKSQKEAELTRELEKQKENKQVEEILRLEKEIEDLQRMKEQQELSLTEASLQKLQERRDQELRRLEEEACRAAQEFLES
Target: MYO10
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200