Moesin Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12473S
Article Name: Moesin Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12473S
Supplier Catalog Number: CNA12473S
Alternative Catalog Number: MBL-CNA12473S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 458-557 of human Moesin (NP_002435.1).
Conjugation: Unconjugated
Alternative Names: HEL70, IMD50
Clonality: Polyclonal
Molecular Weight: 68kDa
NCBI: 4478
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: KTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYK
Target: MSN
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200