CLDN11 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12478P
Article Name: CLDN11 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12478P
Supplier Catalog Number: CNA12478P
Alternative Catalog Number: MBL-CNA12478P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLDN11 (NP_005593.2).
Conjugation: Unconjugated
Alternative Names: OSP, OTM, HLD22
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 5010
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLL
Target: CLDN11
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100