PIK3C3/VPS34 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12483P
Article Name: PIK3C3/VPS34 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12483P
Supplier Catalog Number: CNA12483P
Alternative Catalog Number: MBL-CNA12483P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 130-412 of human PIK3C3/VPS34 (NP_002638.2).
Conjugation: Unconjugated
Alternative Names: VPS34, Vps34, hVps34
Clonality: Polyclonal
Molecular Weight: 102kDa
NCBI: 5289
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: FGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVAR
Target: PIK3C3
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200