PSMD13 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12485S
Article Name: PSMD13 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12485S
Supplier Catalog Number: CNA12485S
Alternative Catalog Number: MBL-CNA12485S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human PSMD13 (NP_002808.3).
Conjugation: Unconjugated
Alternative Names: S11, Rpn9, p40.5, HSPC027
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 5719
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MKDVPGFLQQSQNSGPGQPAVWHRLEELYTKKLWHQLTLQVLDFVQDPCFAQGDGLIKLYENFISEFEHRVNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGALKLNIGDLQVTKETIEDVEEMLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFLGCVDIKDLPVSEQQERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAFNSGNVERFQT
Target: PSMD13
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200