eIF4EBP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1248P
Article Name: eIF4EBP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1248P
Supplier Catalog Number: CNA1248P
Alternative Catalog Number: MBL-CNA1248P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human eIF4EBP1 (NP_004086.1).
Conjugation: Unconjugated
Alternative Names: BP-1, 4EBP1, 4E-BP1, PHAS-I
Clonality: Polyclonal
Molecular Weight: 13kDa
NCBI: 1978
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: TRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Target: EIF4EBP1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:100 - 1:200