[KO Validated] AMPKbeta1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12491S
Article Name: [KO Validated] AMPKbeta1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12491S
Supplier Catalog Number: CNA12491S
Alternative Catalog Number: MBL-CNA12491S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human AMPKbeta1 (NP_006244.2).
Conjugation: Unconjugated
Alternative Names: AMPK, HAMPKb
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 5564
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPT
Target: PRKAB1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100