PEX5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12493T
Article Name: PEX5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12493T
Supplier Catalog Number: CNA12493T
Alternative Catalog Number: MBL-CNA12493T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 364-631 of human PEX5 (NP_000310.2).
Conjugation: Unconjugated
Alternative Names: PXR1, PBD2A, PBD2B, PTS1R, RCDP5, PTS1-BP
Clonality: Polyclonal
Molecular Weight: 71kDa
NCBI: 5830
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: WQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVTPAEEGAGGAGLGPSKRILGSLLSDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADA
Target: PEX5
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200