RBP4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12495S
Article Name: RBP4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12495S
Supplier Catalog Number: CNA12495S
Alternative Catalog Number: MBL-CNA12495S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 19-201 of human RBP4 (NP_006735.2).
Conjugation: Unconjugated
Alternative Names: RDCCAS, MCOPCB10
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 5950
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Target: RBP4
Application Dilute: WB: WB,1:500 - 1:2000