Sonic Hedgehog (Shh) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12503S
Article Name: Sonic Hedgehog (Shh) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12503S
Supplier Catalog Number: CNA12503S
Alternative Catalog Number: MBL-CNA12503S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Sonic Hedgehog (Shh) (NP_000184.1).
Conjugation: Unconjugated
Alternative Names: TPT, HHG1, HLP3, HPE3, SMMCI, ShhNC, TPTPS, MCOPCB5
Clonality: Polyclonal
Molecular Weight: 50kDa
NCBI: 6469
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: PGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLTFLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSATGEPEASSGSGPPSGGALG
Target: SHH
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100