SLC1A4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12507S
Article Name: SLC1A4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12507S
Supplier Catalog Number: CNA12507S
Alternative Catalog Number: MBL-CNA12507S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 140-220 of human SLC1A4 (NP_003029.2).
Conjugation: Unconjugated
Alternative Names: SATT, ASCT1, SPATCCM
Clonality: Polyclonal
Molecular Weight: 56kDa
NCBI: 6509
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: KPGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLARNLFPSNLVVAAFRTYATDYKVVTQNSSSGNVTHEKIPIGTEIEG
Target: SLC1A4
Application Dilute: WB: WB,1:500 - 1:2000