SMN2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12508S
Article Name: SMN2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12508S
Supplier Catalog Number: CNA12508S
Alternative Catalog Number: MBL-CNA12508S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-197 of human SMN2 (NP_059107.1).
Conjugation: Unconjugated
Alternative Names: SMNC, BCD541, GEMIN1, TDRD16B, C-BCD541
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 6607
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPP
Target: SMN2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:20 - 1:50