TCEB1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12515S
Article Name: TCEB1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12515S
Supplier Catalog Number: CNA12515S
Alternative Catalog Number: MBL-CNA12515S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-112 of human TCEB1 (NP_001191791.1).
Conjugation: Unconjugated
Alternative Names: SIII, TCEB1
Clonality: Polyclonal
Molecular Weight: 12kDa
NCBI: 6921
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Target: ELOC
Application Dilute: WB: WB,1:500 - 1:2000