TIA1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12523S
Article Name: TIA1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12523S
Supplier Catalog Number: CNA12523S
Alternative Catalog Number: MBL-CNA12523S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human TIA1 (NP_071505.2).
Conjugation: Unconjugated
Alternative Names: WDM, ALS26, TIA-1
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 7072
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: IGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ
Target: TIA1
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200