DNA topoisomerase I (TOP1) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12524S
Article Name: DNA topoisomerase I (TOP1) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12524S
Supplier Catalog Number: CNA12524S
Alternative Catalog Number: MBL-CNA12524S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNA topoisomerase I (DNA topoisomerase I (TOP1)) (NP_003277.1).
Conjugation: Unconjugated
Alternative Names: TOPI
Clonality: Polyclonal
Molecular Weight: 91kDa
NCBI: 7150
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDA
Target: TOP1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IP,1:20 - 1:50