TRPC1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12525S
Article Name: TRPC1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12525S
Supplier Catalog Number: CNA12525S
Alternative Catalog Number: MBL-CNA12525S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human TRPC1 (NP_001238774.1).
Conjugation: Unconjugated
Alternative Names: TRP1, HTRP-1
Clonality: Polyclonal
Molecular Weight: 91kDa
NCBI: 7220
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEG
Target: TRPC1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200