VEGFC Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12530S
Article Name: VEGFC Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12530S
Supplier Catalog Number: CNA12530S
Alternative Catalog Number: MBL-CNA12530S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human VEGFC (NP_005420.1).
Conjugation: Unconjugated
Alternative Names: VRP, Flt4-L, LMPH1D, LMPHM4
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 7424
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: TISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAANKTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDICGPNKELDEETCQCVCRAGLR
Target: VEGFC
Application Dilute: WB: WB,1:500 - 1:1000