VIP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12531S
Article Name: VIP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12531S
Supplier Catalog Number: CNA12531S
Alternative Catalog Number: MBL-CNA12531S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 31-170 of human VIP (NP_003372.1).
Conjugation: Unconjugated
Alternative Names: PHM27
Clonality: Polyclonal
Molecular Weight: 19kDa
NCBI: 7432
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: APSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK
Target: VIP
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200