COX2/PTGS2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1253P
Article Name: COX2/PTGS2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1253P
Supplier Catalog Number: CNA1253P
Alternative Catalog Number: MBL-CNA1253P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 18-111 of COX2/PTGS2 (NP_000954.1).
Conjugation: Unconjugated
Alternative Names: COX2, COX-2, PHS-2, PGG/HS, PGHS-2, hCox-2, GRIPGHS
Clonality: Polyclonal
Molecular Weight: 69kDa
NCBI: 5743
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: ANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLID
Target: PTGS2
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200