TNFRSF10A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12540S
Article Name: TNFRSF10A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12540S
Supplier Catalog Number: CNA12540S
Alternative Catalog Number: MBL-CNA12540S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 269-468 of human TNFRSF10A (NP_003835.3).
Conjugation: Unconjugated
Alternative Names: DR4, APO2, CD261, TRAILR1, TRAILR-1
Clonality: Polyclonal
Molecular Weight: 50kDa
NCBI: 8797
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: GGDPKCMDRVCFWRLGLLRGPGAEDNAHNEILSNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRRLLVPANGADPTETLMLFFDKFANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAREKIQDLLVDSGKFIYLEDGTGSAVSLE
Target: TNFRSF10A
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100