HDAC3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12542S
Article Name: HDAC3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12542S
Supplier Catalog Number: CNA12542S
Alternative Catalog Number: MBL-CNA12542S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 330 to the C-terminus of human HDAC3 (NP_003874.2).
Conjugation: Unconjugated
Alternative Names: HD3, RPD3, KDAC3, RPD3-2
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 8841
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: EYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
Target: HDAC3
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200