AIP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12546S
Article Name: AIP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12546S
Supplier Catalog Number: CNA12546S
Alternative Catalog Number: MBL-CNA12546S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-330 of human AIP (NP_003968.3).
Conjugation: Unconjugated
Alternative Names: ARA9, XAP2, PITA1, XAP-2, FKBP16, FKBP37, SMTPHN
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 9049
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKLPVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDALQQNPQPLIFHMEMLKVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDQQITPLLLNYCQCKLVVEEYYEVLDHC
Target: AIP
Application Dilute: WB: WB,1:500 - 1:2000