Tyrosinase Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1254P
Article Name: Tyrosinase Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1254P
Supplier Catalog Number: CNA1254P
Alternative Catalog Number: MBL-CNA1254P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Tyrosinase (NP_000363.1).
Conjugation: Unconjugated
Alternative Names: ATN, CMM8, OCA1, OCA1A, OCAIA, SHEP3
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 7299
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: FAHEAPAFLPWHRLFLLRWEQEIQKLTGDENFTIPYWDWRDAEKCDICTDEYMGGQHPTNPNLLSPASFFSSWQIVCSRLEEYNSHQSLCNGTPEGPLRRN
Target: TYR
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200