SLC25A13 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12557S
Article Name: SLC25A13 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12557S
Supplier Catalog Number: CNA12557S
Alternative Catalog Number: MBL-CNA12557S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human SLC25A13 (NP_001153682.1).
Conjugation: Unconjugated
Alternative Names: CTLN2, NICCD, CITRIN, ARALAR2
Clonality: Polyclonal
Molecular Weight: 74kDa
NCBI: 10165
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MAAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVELLSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQVFGQTTIHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDNARTGRVTAIDFRDIMVTIRPHVLTPFVEECLVAAAGGTTSHQVSFSYFNGFNSLLNNMELIRKIYSTLAGTRKDVEVTKEEF
Target: SLC25A13
Application Dilute: WB: WB,1:500 - 1:1000