MAD2B/MAD2L2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12559S
Article Name: MAD2B/MAD2L2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12559S
Supplier Catalog Number: CNA12559S
Alternative Catalog Number: MBL-CNA12559S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-211 of human MAD2B/MAD2B/MAD2L2 (NP_006332.3).
Conjugation: Unconjugated
Alternative Names: REV7, FANCV, MAD2B, POLZ2
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 10459
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS
Target: MAD2L2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200