GABARAP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12568S
Article Name: GABARAP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12568S
Supplier Catalog Number: CNA12568S
Alternative Catalog Number: MBL-CNA12568S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GABARAP (NP_009209.1).
Conjugation: Unconjugated
Alternative Names: MM46, ATG8A, GABARAP-a
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 11337
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHE
Target: GABARAP
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200