[KO Validated] HP1 alpha/CBX5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12577S
Article Name: [KO Validated] HP1 alpha/CBX5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12577S
Supplier Catalog Number: CNA12577S
Alternative Catalog Number: MBL-CNA12577S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HP1 alpha/HP1 alpha/CBX5 (NP_001120794.1).
Conjugation: Unconjugated
Alternative Names: HP1, HP1A, HEL25
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 23468
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADD
Target: CBX5
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200