UQCR10 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12587S
Article Name: UQCR10 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12587S
Supplier Catalog Number: CNA12587S
Alternative Catalog Number: MBL-CNA12587S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human UQCR10 (NP_037519.2).
Conjugation: Unconjugated
Alternative Names: QCR9, UCRC, HSPC051, HSPC119, HSPC151, UCCR7.2
Clonality: Polyclonal
Molecular Weight: 7kDa
NCBI: 29796
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
Target: UQCR10
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200