RASSF5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12602S
Article Name: RASSF5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12602S
Supplier Catalog Number: CNA12602S
Alternative Catalog Number: MBL-CNA12602S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-265 of human RASSF5 (NP_872606.1).
Conjugation: Unconjugated
Alternative Names: RAPL, Maxp1, NORE1, NORE1A, NORE1B, RASSF3
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 83593
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MTVDSSMSSGYCSLDEELEDCFFTAKTTFFRNAQSKHLSKNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLE
Target: RASSF5
Application Dilute: WB: WB,1:500 - 1:2000