SLC32A1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12610S
Article Name: SLC32A1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12610S
Supplier Catalog Number: CNA12610S
Alternative Catalog Number: MBL-CNA12610S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human SLC32A1 (NP_542119.1).
Conjugation: Unconjugated
Alternative Names: VGAT, VIAAT
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 140679
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MATLLRSKLSNVATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWE
Target: SLC32A1
Application Dilute: WB: WB,1:500 - 1:2000