Occludin Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12621P
Article Name: Occludin Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12621P
Supplier Catalog Number: CNA12621P
Alternative Catalog Number: MBL-CNA12621P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human Occludin (NP_002529.1).
Conjugation: Unconjugated
Alternative Names: BLCPMG, PTORCH1, PPP1R115
Clonality: Polyclonal
Molecular Weight: 59kDa
NCBI: 100506658
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: VVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSEL
Target: OCLN
Application Dilute: WB: WB,1:1000 - 1:5000