PRPS2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12645T
Article Name: PRPS2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12645T
Supplier Catalog Number: CNA12645T
Alternative Catalog Number: MBL-CNA12645T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human PRPS2 (NP_002756.1).
Conjugation: Unconjugated
Alternative Names: PRSII
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 5634
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAG
Target: PRPS2
Application Dilute: WB: WB,1:1000 - 1:3000