WWOX Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA12653T
Article Name: |
WWOX Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA12653T |
Supplier Catalog Number: |
CNA12653T |
Alternative Catalog Number: |
MBL-CNA12653T |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human, Mouse, Rat |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human WWOX (NP_057457.1). |
Conjugation: |
Unconjugated |
Alternative Names: |
FOR, WOX1, DEE28, EIEE28, FRA16D, SCAR12, HHCMA56, PRO0128, SDR41C1, D16S432E |
Clonality: |
Polyclonal |
Molecular Weight: |
47kDa |
NCBI: |
51741 |
Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.01% thimerosal,50% glycerol |
Sequence: |
MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGR |
Target: |
WWOX |
Application Dilute: |
WB: WB,1:1000 - 1:2000 |