IFT74 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA12672T
Article Name: |
IFT74 Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA12672T |
Supplier Catalog Number: |
CNA12672T |
Alternative Catalog Number: |
MBL-CNA12672T |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human, Mouse, Rat |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-372 of human IFT74 (NP_001092694.1). |
Conjugation: |
Unconjugated |
Alternative Names: |
CMG1, BBS22, CCDC2, CMG-1, JBTS40, SPGF58 |
Clonality: |
Polyclonal |
Molecular Weight: |
69kDa |
NCBI: |
80173 |
Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.01% thimerosal,50% glycerol |
Sequence: |
MASNHKSSAARPVSRGGVGLTGRPPSGIRPLSGNIRVATAMPPGTARPGSRGCPIGTGGVLSSQIKVAHRPVTQQGLTGMKTGTKGPQRQILDKSYYLGLLRSKISELTTEVNKLQKGIEMYNQENSVYLSYEKRAETLAVEIKELQGQLADYNMLVDKLNTNTEMEEVMNDYNMLKAQNDRETQSLDVIFTERQAKEKQIRSVEEEIEQEKQATDDIIKNMSFENQVKYLEMKTTNEKLLQELDTLQQQLDSQ |
Target: |
IFT74 |
Application Dilute: |
WB: WB,1:1000 - 1:3000 |