SLC1A5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12676S
Article Name: SLC1A5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12676S
Supplier Catalog Number: CNA12676S
Alternative Catalog Number: MBL-CNA12676S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC1A5 (NP_005619.1).
Conjugation: Unconjugated
Alternative Names: R16, AAAT, ATBO, M7V1, RDRC, ASCT2, M7VS1
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 6510
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRANLLVLLTVVAVVAGVALGLGVSGAGGALALGPERLSAFVFPGELLLRLL
Target: SLC1A5
Application Dilute: WB: WB,1:500 - 1:2000