BRD4 Rabbit mAb, Clone: [ARC0699], Unconjugated, Monoclonal

Catalog Number: MBL-CNA12677S
Article Name: BRD4 Rabbit mAb, Clone: [ARC0699], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA12677S
Supplier Catalog Number: CNA12677S
Alternative Catalog Number: MBL-CNA12677S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human BRD4 (O60885).
Conjugation: Unconjugated
Alternative Names: CAP, MCAP, HUNK1, HUNKI, FSHRG4
Clonality: Monoclonal
Clone Designation: [ARC0699]
Molecular Weight: 152kDa
NCBI: 23476
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: IIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRGRGRKETGTAKPGVSTVPNTT
Target: BRD4
Application Dilute: WB: WB,1:500 - 1:2000| IHC-P,1:50 - 1:200