AREG Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12680P
Article Name: AREG Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12680P
Supplier Catalog Number: CNA12680P
Alternative Catalog Number: MBL-CNA12680P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF
Species Reactivity: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-252 of human AREG (NP_001648.1).
Conjugation: Unconjugated
Alternative Names: AR, SDGF, AREGB, CRDGF
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 374
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: SGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA
Target: AREG
Application Dilute: WB: IF/ICC,1:50 - 1:200