Aromatase (CYP19A1) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12684T
Article Name: Aromatase (CYP19A1) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12684T
Supplier Catalog Number: CNA12684T
Alternative Catalog Number: MBL-CNA12684T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human Aromatase (CYP19A1) (NP_000094.2).
Conjugation: Unconjugated
Alternative Names: ARO, ARO1, CPV1, CYAR, CYP19, CYPXIX, P-450AROM
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 1588
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN
Target: CYP19A1
Application Dilute: WB: WB,1:1000 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200