PGK1 Rabbit mAb, Clone: [ARC0700], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA12686S
| Article Name: |
PGK1 Rabbit mAb, Clone: [ARC0700], Unconjugated, Monoclonal |
| Biozol Catalog Number: |
MBL-CNA12686S |
| Supplier Catalog Number: |
CNA12686S |
| Alternative Catalog Number: |
MBL-CNA12686S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PGK1 (P00558). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
PGKA, MIG10, HEL-S-68p |
| Clonality: |
Monoclonal |
| Clone Designation: |
[ARC0700] |
| Molecular Weight: |
45kDa |
| NCBI: |
5230 |
| Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequence: |
MSLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGRPDGVPMPDKYSLEPVAVELKSLLGKDVLFLKDCV |
| Target: |
PGK1 |
| Application Dilute: |
WB: WB,1:500 - 1:1000 |
