[KO Validated] MEK1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12687T
Article Name: [KO Validated] MEK1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12687T
Supplier Catalog Number: CNA12687T
Alternative Catalog Number: MBL-CNA12687T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEK1 (NP_002746.1).
Conjugation: Unconjugated
Alternative Names: MEL, CFC3, MEK1, MKK1, MAPKK1, PRKMK1
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 5604
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIH
Target: MAP2K1
Application Dilute: WB: WB,1:1000 - 1:3000|IHC-P,1:50 - 1:200