VEGFB Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12689T
Article Name: VEGFB Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12689T
Supplier Catalog Number: CNA12689T
Alternative Catalog Number: MBL-CNA12689T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 40-100 of mouse VEGFB (NP_035827.1).
Conjugation: Unconjugated
Alternative Names: VRF, VEGFL
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 7423
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: DVYARATCQPREVVVPLSMELMGNVVKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQ
Target: VEGFB
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200