TFPI Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12692T
Article Name: TFPI Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12692T
Supplier Catalog Number: CNA12692T
Alternative Catalog Number: MBL-CNA12692T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 29-224 of human TFPI (NP_001027452.1).
Conjugation: Unconjugated
Alternative Names: EPI, TFI, LACI, TFPI1
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 7035
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFVTKEGTNDGWKNAAH
Target: TFPI
Application Dilute: WB: WB,1:1000 - 1:2000