NLRP3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12694P
Article Name: NLRP3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12694P
Supplier Catalog Number: CNA12694P
Alternative Catalog Number: MBL-CNA12694P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human NLRP3 (NP_004886.3).
Conjugation: Unconjugated
Alternative Names: AII, AVP, FCU, MWS, FCAS, KEFH, CIAS1, FCAS1, NALP3, C1orf7, CLR1.1, DFNA34, PYPAF1, AGTAVPRL
Clonality: Polyclonal
Molecular Weight: 118kDa
NCBI: 114548
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: QDRFDYLFYIHCREVSLVTQRSLGDLIMSCCPDPNPPIHKIVRKPSRILFLMDGFDELQGAFDEHIGPLCTDWQKAERGDILLSSLIRKKLLPEASLLITT
Target: NLRP3
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200