Sonic Hedgehog (Shh) Rabbit mAb, Clone: [ARC0701], Unconjugated, Monoclonal

Catalog Number: MBL-CNA12695S
Article Name: Sonic Hedgehog (Shh) Rabbit mAb, Clone: [ARC0701], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA12695S
Supplier Catalog Number: CNA12695S
Alternative Catalog Number: MBL-CNA12695S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Sonic Hedgehog (Shh) (Q15465).
Conjugation: Unconjugated
Alternative Names: TPT, HHG1, HLP3, HPE3, SMMCI, ShhNC, TPTPS, MCOPCB5
Clonality: Monoclonal
Clone Designation: [ARC0701]
Molecular Weight: 50kDa
NCBI: 6469
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: PGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLTFLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSATGEPEASSGSGPPSGGALG
Target: SHH
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200