PSME3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12697T
Article Name: PSME3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12697T
Supplier Catalog Number: CNA12697T
Alternative Catalog Number: MBL-CNA12697T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human PSME3 (NP_005780.2).
Conjugation: Unconjugated
Alternative Names: Ki, PA28G, HEL-S-283, PA28gamma, REG-GAMMA, PA28-gamma
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 10197
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: KVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY
Target: PSME3
Application Dilute: WB: WB,1:1000 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200