KLRD1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12698T
Article Name: KLRD1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12698T
Supplier Catalog Number: CNA12698T
Alternative Catalog Number: MBL-CNA12698T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 32-179 of human KLRD1 (NP_002253.1).
Conjugation: Unconjugated
Alternative Names: CD94
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 3824
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: KNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
Target: KLRD1
Application Dilute: WB: WB,1:500 - 1:2000