[KO Validated] KRAS Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12704T
Article Name: [KO Validated] KRAS Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12704T
Supplier Catalog Number: CNA12704T
Alternative Catalog Number: MBL-CNA12704T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-188 of human KRAS (NP_004976.2).
Conjugation: Unconjugated
Alternative Names: NS, NS3, OES, CFC2, RALD, K-Ras, KRAS1, KRAS2, RASK2, KI-RAS, C-K-RAS, K-RAS2A, K-RAS2B, K-RAS4A, K-RAS4B, K-Ras 2, C-K-RAS, c-Ki-ras, c-Ki-ras2
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 3845
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: DEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKCVIM
Target: KRAS
Application Dilute: WB: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200