ACKR3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12712P
Article Name: ACKR3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12712P
Supplier Catalog Number: CNA12712P
Alternative Catalog Number: MBL-CNA12712P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ACKR3 (NP_064707.1).
Conjugation: Unconjugated
Alternative Names: RDC1, CXCR7, RDC-1, CMKOR1, CXC-R7, CXCR-7, GPR159
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 57007
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: TNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSS
Target: ACKR3
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200