LSM1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12732T
Article Name: LSM1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12732T
Supplier Catalog Number: CNA12732T
Alternative Catalog Number: MBL-CNA12732T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-133 of human LSM1 (NP_055277.1).
Conjugation: Unconjugated
Alternative Names: CASM, YJL124C
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 27257
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY
Target: LSM1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200