ACE2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12737P
Article Name: ACE2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12737P
Supplier Catalog Number: CNA12737P
Alternative Catalog Number: MBL-CNA12737P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ACE2 (NP_068576.1).
Conjugation: Unconjugated
Alternative Names: ACEH
Clonality: Polyclonal
Molecular Weight: 92kDa
NCBI: 59272
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: GDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQ
Target: ACE2
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200